Loading...

CERAGEM..CERAJADE........LOWEST PRICE IN COUNTRY - Coimbatore

CERAGEM..CERAJADE........LOWEST PRICE IN COUNTRY - Coimbatore
Ad Details
Posted By : Dealer    Posted On : 16-Jul-2014

lowest prices on Cerajade Ceragem machines in whole country.

Home use device at just Rs.8990/=

Used Ceragem in new condition at just 50%

Many more Therapy products available with us.

All India Dealers wanted.

Call me at: 9810003732. When you call, don't forget to mention that you found this ad on Quikr.

Share this on
9810003732 Send Free SMS
Furnish your home afresh! Choose from 50000+ products. Starting from Rs. 100, Know More!
Will redirect to www.junglee.com
Recommended Health - Beauty Products for You
50 % BOOST DISCOUNT HERBALIFE PRODUCTS - 09786663730
50 % boost discount herbalife products - 09786663730 f1 shake – rs. 983.protein– rs. 584. afr...
Health - Beauty Products
||
Contact for Price
2 hours ago
GAS SAFETY DEVICE FOR SAFETY & INDICATES GAS LEVEL ALSO SAVES 20% OF GAS
Gas safety deviceaccording to the information gathered from the fire accident sources, 90% of f...
Health - Beauty Products
||
Contact for Price
5 hours ago
START A NEW LIFE AFTER QUITING ADDICTIONS
Quit addictionstart a new life after quiting addictions quit addiction powder is a mixture of 1...
Health - Beauty Products
||
Contact for Price
5 hours ago
STEAM BATH at your Home in Best Price
Product specification steam life - portable steam sauna we are engaged in offering our clients ...
Rs 3,499
6 hours ago
No side effect apply any part of the bodyTala ant egg oil permanent hair remover
(ciunyguyvrncmyreycwrpywytiretpimvclkmdk) working of ant egg oil and permanent hair removal ...
Contact for Price
9 hours ago
Ads by Google
Check MSP